PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00111627001
Common NameGSBRNA2T00111627001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 136aa    MW: 15531.7 Da    PI: 10.5445
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00111627001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.54.6e-2660113155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +pr  Wtp+LH+rF++a+e+L G+  AtPkti e+m+v+gLt+  v+SHLQ YRl
  GSBRNA2T00111627001  60 RPRKIWTPQLHQRFLDAIEHL-GISDATPKTITEFMNVEGLTRWSVASHLQIYRL 113
                          5899*****************.9999****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.08E-1757115IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-2459115IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-2361114IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MREDDSNWFA GWKEELPSPN RLMPLSQSQP MPSQLQLPSP QANSSADRGS GDEPARTLRR  60
PRKIWTPQLH QRFLDAIEHL GISDATPKTI TEFMNVEGLT RWSVASHLQI YRLQLAGNER  120
HRKLIASFPV CKRKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-1759115460ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.49830.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00111627001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894310.0AC189431.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068B07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608170.12e-46PREDICTED: transcription factor LUX-like
RefseqXP_006298091.12e-44hypothetical protein CARUB_v10014134mg
SwissprotQ9SNB41e-27PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078CAM05e-97A0A078CAM0_BRANA; BnaA03g31400D protein
STRINGBra001377.1-P6e-94(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15903712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.13e-32G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]